Raman). Нативная структура, денатурация и агрегация белка. Методы исследования стабильности
белков (CD, DSC, DSF). Примеры.Николай Николаевич Случанко
Разделы презентаций
- Разное
- Английский язык
- Астрономия
- Алгебра
- Биология
- География
- Геометрия
- Детские презентации
- Информатика
- История
- Литература
- Математика
- Медицина
- Менеджмент
- Музыка
- МХК
- Немецкий язык
- ОБЖ
- Обществознание
- Окружающий мир
- Педагогика
- Русский язык
- Технология
- Физика
- Философия
- Химия
- Шаблоны, картинки для презентаций
- Экология
- Экономика
- Юриспруденция
Лекция 2
Содержание
- 1. Лекция 2
- 2. План 6 лекцийМетоды определения размера, массы, олигомерного
- 3. Стандартные аминокислоты, входящие в состав белков
- 4. Различные уровни структурной организации белков
- 5. Мы выделили и очистили рекомбинантный белок, знаем,
- 6. Mass-spectrometryA toolkit of methods to accurately determine
- 7. Принцип методаИонизируем молекулы, переводим ионы в газовую фазу и делим их по отношению m/zСеменюк П.И.
- 8. Способы ионизации для МС
- 9. Способы ионизации для МСESI
- 10. Способы ионизации для МСESIMALDI
- 11. Семенюк П.И.
- 12. Снова про разрешение…
- 13. Слайд 13
- 14. Как посчитать массу иона, зная соседние пики m/z ?Пример
- 15. Способы разделения ионовTOFQuadrupoleIon TrapMagnetic sectorCombinations are often used!
- 16. МС подходы к идентификации и характеристике белка: «прямой» и «кверх ногами»http://www.chromatographyonline.com/top-down-versus-bottom-approaches-proteomics-0
- 17. Применимость анализаторов ионов для top-down
- 18. Two types of the “bottom-up” protein identificationPeptide
- 19. Как правило, однозарядные ионы -> тривиальное определение их массы из m/z
- 20. Тандемная масс-спектрометрия
- 21. Monoisotopic masses of amino acids80Da phosphorylationSimilar masses!Identical masses!Identical masses!Similar masses!
- 22. Тандемная масс-спектрометрия
- 23. MS/MS for indentifying terminal truncations in protein sequence>sp|O14558|1-160MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK>sp|O14558|1-160MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQA
- 24. MS/MS for indentifying PTMsm/zm/zMS spectrumMS/MS spectrum of the 1641 Da phosphopeptide…RSpSWRVVSSIEQK…
- 25. Конец лекции 18.11.19
- 26. Secondary structure elementsα-helixβ-strandTurns and loopsRandom coil Protein
- 27. Предсказание вторичной структуры белка по его последовательностиhttp://www.compbio.dundee.ac.uk/jpred4/index_up.html
- 28. Secondary structure prediction based on STARD1 protein
- 29. Light Spectrum
- 30. Изменение энергии молекулы (ΔЕ) при взаимодействии с квантом света (hν)https://biomolecula.ru/articles/spektroskopiia-kr-novye-vozmozhnosti-starogo-metoda
- 31. Main protein chromophores
- 32. Absorption in far-UV by secondary structuresThe differences
- 33. Chirality and optical activity
- 34. α-helices and β-cheets are optically active
- 35. Polarization of light
- 36. Polarization of lighthttps://www.youtube.com/watch?v=8YkfEft4p-w
- 37. Circularly polarized light can be absorbed
- 38. Units of CDДихроичное поглощениеМолярный дихроизмМолярный дихроизмМолярная эллиптичность
- 39. Far-UV CD spectroscopy
- 40. Far-UV CD spectroscopyThe resulting spectra are a
- 41. Alpha-helix content determination using an empirical formulaGreenfield, N.; Fasman, G. D. Biochemistry 1969, 8, 4108–4116.
- 42. Слайд 42
- 43. STARD1 far-UV spectrum analysis using DichroWebSluchanko et al Prot. Exp. Purif. 2016
- 44. ApplicationsDetermination of 2° structure content in a
- 45. Stabilization of a protein by its partnerSluchanko
- 46. Monomerization of a protein reduces the stability of its alpha-helical structureSluchanko, Uversky BBA Proteins 2015Engineered mutation
- 47. Far-UV CDVery convenient, sensitive, non-invasive techniqueSmall sample
- 48. Aromatic residues are chromophoresResonance double bondsAbsorb UV
- 49. Near-UV CD for assessment of tertiary structure
- 50. Bova et al PNAS 1999For wild-type αB-crystallin10%
- 51. Fourier-Transform Infrared (FTIR) spectroscopy X axis –
- 52. Interference
- 53. Interference
- 54. Interferometer
- 55. FTIR spectroscopy requires Fourier transformation of raw
- 56. Fourier transformSignal in time domainSignal in frequency domain
- 57. Слайд 57
- 58. Buffer subtraction from sampleWater absorbs !Analysis in thin films and cuvettes, capillaries
- 59. FTIR spectroscopy for studying 2° structuresThe workflow
- 60. Protein bands in a FTIR spectrum
- 61. Processing of the raw spectrum2nd derivativeraw spectrumCurve-fitted inverse derivative spectrum
- 62. Unfolding of HSPB8 induced by temperature as
- 63. Raman spectroscopyComplimentary to IR spectroscopy, but relies
- 64. Raman spectroscopyC.V. Raman,1930 Nobel PrizeElastic scatteringRaman scatteringMust be filtered out!Очень слабые сигналы!
- 65. Комбинационное рассеяние света(эффект Рамана) — неупругое рассеяние оптического излучения на
- 66. Выявление различных веществ по ключевым пикам на спектре КР сложной смеси
- 67. Raman spectroscopy (=комбинационное рассеяние света)The focus of
- 68. Raman spectroscopy (=комбинационное рассеяние света)
- 69. Raman spectrumLaser frequency (0 cm-1)Stokes shifts
- 70. Raman spectrum
- 71. Raman microscope
- 72. Information extracted from Raman spectraThe Raman shifts
- 73. Raman spectra – protein 2° structureResonance Raman
- 74. Intrinsic fluorescence and tertiary structureStokes (red) shift
- 75. Trp location and fluorescence spectraclass A (λm
- 76. Protein folding
- 77. Protein quality control
- 78. Thermal stability of proteinsEnzyme activity (T) CD DSFDSCThermal shift assays:
- 79. Differential scanning fluorimetry (DSF)Может быть не только белковый флуорофор!Либо внешняя, либо иммобилизованная меткаhttps://www.nature.com/articles/nprot.2007.321 nanoDSF10 µl
- 80. Data transformationTrp fluorescenceWavelength, nmλ1λ2λmaxI(λ1)/I(λ2)T, CTrp emission spectrumT0.51
- 81. ThermofluorExtrinsic dyes: supro orange, 1,8-ANS, Nile redqPCR machine
- 82. Thermofluor – effect of ligands
- 83. DSF and high-throughputDOI: 10.1007/978-1-4939-7577-8_23In book: Bacterial ChemosensingScreening of
- 84. DSF and high-throughput
- 85. Дифференциальная сканирующая калориметрия (ДСК, DSC)
- 86. Теплота и калорияКоличество энергии, которое теряет или
- 87. Принцип метода ДСКДСК основан на нагревании или
- 88. ОпределенияТепловой потокСкорость нагреванияТеплопоглощение(переданное тепло, отнесенное к приросту температуры)
- 89. Взаимосвязь потока тепла в единицу времени (мощность) и температурыПостоянная мощностьИзмеряем температуруПостоянная скорость нагреваИзмеряем мощностьСеменюк П.И.
- 90. Постоянная мощностьИзмеряем температуруПостоянная скорость нагреваИзмеряем мощностьСеменюк П.И.
- 91. Постоянная мощностьИзмеряем температуруПостоянная скорость нагреваИзмеряем мощностьСеменюк П.И.
- 92. Эндотермические и экзотермические тепловые эффекты
- 93. Что получаем в итоге опыта?
- 94. Энтальпия
- 95. Калориметрия мультидоменных белков
- 96. Сочетание разных методов изучения термостабильности
- 97. Требования к образцу и установкеОбразец не должен
- 98. Скачать презентанцию
План 6 лекцийМетоды определения размера, массы, олигомерного состояния и гидродинамических свойств белков (EM, AFM, DLS, AUC, SEC, AF4). Примеры.Первичная структура, идентификация белка. Масс-спектрометрия. Спектральные методы (CD, IR, Raman). Нативная структура, денатурация
Слайды и текст этой презентации
Слайд 1Лекция 2
Первичная структура, идентификация белка. Масс-спектрометрия. Спектральные методы (CD, IR,
Слайд 2План 6 лекций
Методы определения размера, массы, олигомерного состояния и гидродинамических
свойств белков (EM, AFM, DLS, AUC, SEC, AF4). Примеры.
Первичная структура,
идентификация белка. Масс-спектрометрия. Спектральные методы (CD, IR, Raman). Нативная структура, денатурация и агрегация белка. Методы исследования стабильности белков (CD, DSC, DSF). Примеры.Рентгеновская кристаллография (macromolecular crystallography, MX). Нейтронная и электронная кристаллография. Работа со структурными моделями (PBD и PyMOL). Примеры.
Малоугловое рассеяние лучей (SAXS и SANS). Примеры
Другие методы исследования структуры белков (NMR, Cryo-EM, Cryo-electrotomography, native-MS, HDX-MS). Интегральный подход и моделирование белков по гомологии (iTasser). Примеры.
Методы исследования белок-белковых взаимодействий (Co-IP, equilibrium dialysis, ITC, SPR, BLIC, MST, QMb, SESC). Примеры.
Слайд 5Мы выделили и очистили рекомбинантный белок, знаем, какая должна быть
его последовательность, что дальше? Как ее проверить? Или Видим появление некоторого белка,
но не знаем, что это за белок? Или Полученный белок представлен несколькими полосами в ПААГ. Что за полосы? Или Белок модифицирован, но по каким участкам? Или Полученный белок меньше по размеру, чем ожидали, как выяснить, почему? Или В препарате присутствует грязь, что это? Или Производим химическое «сшивание» белкового олигомера, хотим понять, боковые цепи каких остатков задействованы?7 бед – один ответ
Слайд 6Mass-spectrometry
A toolkit of methods to accurately determine masses in a
sample
Required steps:
Ionization is the required step (ions with different masses
will show different properties)Acceleration and separation of ions
Detection of different ions (m and z) to get a spectrum
Purposes:
Protein identification
Impurities detection
Study of modifications (e.g., PTMs)
More sophisticated approaches:
Proteomic scale analysis of proteomes and its changes
Analysis of the oligomeric distribution and complexes (native-MS)
Слайд 7Принцип метода
Ионизируем молекулы,
переводим ионы в газовую фазу
и делим их по
отношению m/z
Семенюк П.И.
Слайд 16МС подходы к идентификации и характеристике белка: «прямой» и «кверх
ногами»
http://www.chromatographyonline.com/top-down-versus-bottom-approaches-proteomics-0
Слайд 18Two types of the “bottom-up” protein identification
Peptide mass fingerprinting after
proteolytic digestion and comparison with the predicted masses derived from
the “idealistic” cleavage by this enzymeonly pure proteins or very simple mixtures
can be ambiguous as several identical masses may be derived from different proteins
Can be done on MS/MS instruments, but also on MALDI-TOF.
Tandem MS (or MS/MS)
Ion is separated from others and subjected to fragmentation within the instrument
The aa sequence is deduced from the masses of fragment ions
Basically, de novo sequencing of a protein
Is not subject to high-throughput analysis
“Uninterpreted” proteomics (product ion spectra are cross-correlated with the databases to find an annotated protein giving the same spectrum
Слайд 21Monoisotopic masses of amino acids
80Da phosphorylation
Similar masses!
Identical masses!
Identical masses!
Similar masses!
Слайд 23MS/MS for indentifying terminal truncations in protein sequence
>sp|O14558|1-160
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
>sp|O14558|1-160
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQA
Слайд 24MS/MS for indentifying PTMs
m/z
m/z
MS spectrum
MS/MS spectrum of the 1641 Da
phosphopeptide
…RSpSWRVVSSIEQK…
Слайд 26Secondary structure elements
α-helix
β-strand
Turns and loops
Random coil
Protein conformation is stabilized
largely by weak interactions and is therefore labile
>sp|O14558|1-160
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
Слайд 27Предсказание вторичной структуры белка по его последовательности
http://www.compbio.dundee.ac.uk/jpred4/index_up.html
Слайд 28Secondary structure prediction based on STARD1 protein sequence
alpha helix ('H'),
beta sheet ('E') or not H or E ('-')
using a
neural network called JnetWhat is the real secondary structure composition of a given protein?
Слайд 30Изменение энергии молекулы (ΔЕ) при взаимодействии с квантом света (hν)
https://biomolecula.ru/articles/spektroskopiia-kr-novye-vozmozhnosti-starogo-metoda
Слайд 32Absorption in far-UV by secondary structures
The differences in the linear
absorption exist, but are not sufficient to tell the secondary
structure composition in a protein
Слайд 40Far-UV CD spectroscopy
The resulting spectra are a combination of contributions
from alpha-helical, beta-stranded, and random coil structural elements
CD spectra of
a protein can be deconvoluted using the reference spectra to derive the proportion of α, β, random coils
Слайд 41Alpha-helix content determination using an empirical formula
Greenfield, N.; Fasman, G.
D. Biochemistry 1969, 8, 4108–4116.
Слайд 44Applications
Determination of 2° structure content in a protein of interest
The
effect of ligand binding on the 2° structure of a
proteinEffect of mutations and modifications on the 2° structure
Conformational changes in response to buffer composition changes
Protein folding and unfolding
Protein-protein interactions
Kinetics of 2° structure changes in response to anything
Слайд 45Stabilization of a protein by its partner
Sluchanko et al Biochemistry
2012
49.5°C
53°C
pH-dependent conformational change
Busch et al JBC 1998
Слайд 46Monomerization of a protein reduces the stability of its alpha-helical
structure
Sluchanko, Uversky BBA Proteins 2015
Engineered mutation
Слайд 47Far-UV CD
Very convenient, sensitive, non-invasive technique
Small sample consumption (50-100 µl,
0.5-1 mg/ml), sample can be re-used!
Very good for a-helical proteins,
worse for unfolded and beta-folded proteinsNitrogen gas is used to minimize O2 associated absorbance
Equipment is expensive!
Chirascan (Applied Photophysics)
Слайд 48Aromatic residues are chromophores
Resonance double bonds
Absorb UV light around 280
nm
Proteins therefore give characteristic Abs spectra, which is useful for
their detectionNear-UV
Слайд 49Near-UV CD for assessment of tertiary structure features
Is sensitive to
the environment!
Higher protein C than for far-UV CD, the signals
are weak!UV region
Far-UV (190-260 nm)
Near-UV (250-320 nm)
Слайд 50Bova et al PNAS 1999
For wild-type αB-crystallin
10% α-helix,
44% β-sheet,
45% unfolded
For R120G αB-crystallin
15% α-helix
33% β-sheet
52% unfolded
Near-UV CD indicates that
mutation in alpha-B crystallin affects both its 2° and 3° structureCD is not great for beta-structured proteins!!!
Слайд 51Fourier-Transform Infrared (FTIR) spectroscopy
X axis – wavenumbers (cm-1)
1650 cm-1
= 0.01/1650 ~ 6 µm = 6000 nm
Many frequences are
present in the incident beam at a time!Analysis of molecular vibrations!
Michelson interferometer
Слайд 55FTIR spectroscopy requires Fourier transformation of raw data to get
spectrum
The FTIR interferogram (dependence on the mirror position) is transformed
into spectrum (wavelength dependence) by Fourier transformation Time or mirror position
Слайд 58Buffer subtraction from sample
Water absorbs !
Analysis in thin films and
cuvettes, capillaries
Слайд 59FTIR spectroscopy for studying 2° structures
The workflow for structure analysis:
measurement
of the protein sample extinction
amide I band decomposition
integration of the
calculated componentsβ
α
Слайд 61Processing of the raw spectrum
2nd derivative
raw spectrum
Curve-fitted inverse derivative spectrum
Слайд 62Unfolding of HSPB8 induced by temperature as monitored by FTIR
Kazakov
et al Biophys Chem 2009
12% α-helix
33% β-sheet
55% unfolded
0%
α-helix 18% β-sheet
82% unfolded
20C
70C
Слайд 63Raman spectroscopy
Complimentary to IR spectroscopy, but relies on scattering instead
of absorption
Possibility to measure directly in water, non-invasively, while IR
is absorbed by water 
Слайд 64Raman spectroscopy
C.V. Raman,
1930 Nobel Prize
Elastic scattering
Raman scattering
Must be filtered out!
Очень
слабые сигналы!
Слайд 65Комбинационное рассеяние света
(эффект Рамана) — неупругое рассеяние оптического излучения на молекулах вещества (твёрдого,
жидкого или газообразного), сопровождающееся заметным изменением частоты излучения. В отличие от рэлеевского рассеяния,
в случае комбинационного рассеяния в спектре рассеянного излучения появляются спектральные линии, которых нет в спектре возбуждающего света. Число и расположение появившихся линий определяется молекулярным строением вещества.Название «комбинационное» рассеяние означает, что спектр рассеяния представляет собой комбинацию частот возбуждающего света и собственных колебаний молекулы
https://biomolecula.ru/articles/spektroskopiia-kr-novye-vozmozhnosti-starogo-metoda
Слайд 67Raman spectroscopy (=комбинационное рассеяние света)
The focus of Raman spectroscopy
Very weak
signals (elastic scattering dominates)
Inefficient process (1/106 events)
Efficiency drops as λ
increases - 1/ λ4455 nm
532 nm
628 nm
785 nm
1064 nm
E1
E0
Laser source
Eff.drops
Shielded by fluorescence
Колебательные подуровни
Электронные уровни , E0,E1
Слайд 72Information extracted from Raman spectra
The Raman shifts and relative intensities
of all of the bands of the material leads to
its identificationIndividual band changes – indication of the environment changes of the molecule under study
Слайд 73Raman spectra – protein 2° structure
Resonance Raman spectra – near
the electronic transition frequency
Curr Opin Struct Biol. 2008 Oct; 18(5):
623–629.F – Phe
Y – Tyr
W – Trp
Слайд 75Trp location and fluorescence spectra
class A (λm = 308 nm,
structured spectra) - the fluorophores, which do not form hydrogen-bound
complexes in the excited state (exciplexes) with solvent or neighboring protein groups;class S (λm = 316 nm, structured spectra) includes the buried tryptophan residues that can form the exciplexes with 1:1 stoichiometry;
class I (λm = 330-332 nm, Δλ = 48-50 nm) represents the buried fluorophores that can form the exciplexes with 2:1 stoichiometry;
class II (λm = 340-342 nm, Δλ = 53-55 nm) represents the fluorophores exposed to the bound water possessing very long dipole relaxation time, which precludes the completing the relaxation-induced spectral shift during the excited state lifetime;
class III (λm= 350-353 nm, Δλ = 59-61 nm) contains rather fully exposed fluorophores surrounded with highly mobile water completely relaxing during the excitation lifetime, which makes their spectra almost coinciding with those of free aqueous tryptophan;
http://pfast.phys.uri.edu/background/background.php
Слайд 79Differential scanning fluorimetry (DSF)
Может быть не только белковый флуорофор!
Либо внешняя,
либо иммобилизованная метка
https://www.nature.com/articles/nprot.2007.321
nanoDSF
10 µl
Слайд 80Data transformation
Trp fluorescence
Wavelength, nm
λ1
λ2
λmax
I(λ1)/I(λ2)
T, C
Trp emission spectrum
T0.5
1
Слайд 83DSF and high-throughput
DOI: 10.1007/978-1-4939-7577-8_23
In book: Bacterial Chemosensing
Screening of ligands (bind or
not)
Optimization of crystallization conditions
Optimization of protein mutant forms (enzyme stability
for biotechnology)Screening for detergents in case of membrane proteins
Assessment of quality of protein preparation
Слайд 86Теплота и калория
Количество энергии, которое теряет или получает тело в
течение времени в форме теплового потока
Единица измерения – Джоуль или
калория Приборы, измеряющие теплоту, выделяемую или поглощаемую в различных процессах – калориметры
Фактически регистрируются тепловые эффекты (отдача или поглощение тепла), сопровождающие изменения в образце в условиях программирования температуры
Дифференциальный способ анализа – разность температур между неким эталоном и образцом
Слайд 87Принцип метода ДСК
ДСК основан на нагревании или охлаждении образца и
эталона с заданной скоростью при сохранении их температур и измерении
теплового потока, поддерживающего температуру образца в пределах заданной программы (например, 1 град С в минуту) – при сканированиинагревателю ячейки с образцом придется работать усерднее, чем нагревателю под эталоном. Он должен выделять больше тепла. И насколько именно больше - цель опыта ДСК
Слайд 88Определения
Тепловой поток
Скорость нагревания
Теплопоглощение
(переданное тепло, отнесенное к приросту температуры)
Слайд 89Взаимосвязь потока тепла в единицу времени (мощность) и температуры
Постоянная мощность
Измеряем
температуру
Постоянная
скорость нагрева
Измеряем мощность
Семенюк П.И.
Слайд 90Постоянная мощность
Измеряем температуру
Постоянная
скорость нагрева
Измеряем мощность
Семенюк П.И.
Слайд 91Постоянная мощность
Измеряем температуру
Постоянная
скорость нагрева
Измеряем мощность
Семенюк П.И.
Слайд 97Требования к образцу и установке
Образец не должен взаимодействовать с материалом
измерительной ячейки (платина)
Нужно предотвратить выкипание образца (давление)
Нужно хороший тепловой контакт
образца с тепловым сенсором и предотвратить агрегацию белка (тонкие капиллярные ячейки)50 образцов в день
2-5 образцов в день
